CookSnap is coming soon — Join the waitlist →

Crispy Herb Stuffed Peppers

Halved bell peppers stuffed with crispy breadcrumbs, feta, and herbs, then roasted until charred. A Mediterranean weeknight dinner that feels restaurant-worthy but takes 25 minutes.

Total time
25 min
Servings
2
Calories
285
Protein
11g
Crispy Herb Stuffed Peppers
simpleelegantmediterraneanvegetariancheesecrispytenderweeknight

Ingredients

  • 2 whole bell peppers (red or yellow), halved and seeded
  • ¾ cup panko breadcrumbs
  • ½ cup feta cheese, crumbled
  • ¼ cup fresh parsley and dill, chopped
  • 1 whole lemon (zested + juiced)
  • ¾ cup cherry tomatoes, halved
  • 3 tbsp olive oil

Instructions

  1. 1

    Heat oven to 425°F. Place pepper halves on a sheet pan and drizzle with 1 tbsp olive oil, salt, and pepper.

  2. 2

    In a bowl, combine panko, feta, parsley, dill, lemon zest, and remaining 2 tbsp olive oil until breadcrumbs look moistened and clumpy.

  3. 3

    Divide cherry tomatoes among pepper halves, then top each with the breadcrumb mixture, pressing gently so it sticks.

  4. 4

    Roast for 15 minutes until pepper edges char and breadcrumb topping turns golden brown and crispy.

  5. 5

    Squeeze lemon juice over the top and serve hot straight from the pan.

Tools you’ll need

  • sheet pan
  • small bowl
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.