CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Herb Stuffed Tomatoes

Hollow tomato halves stuffed with garlicky breadcrumbs, herbs, and feta, then roasted until the tops crisp up. A complete vegetarian dinner that feels fancy but takes 25 minutes.

Total time
25 min
Servings
4
Calories
318
Protein
11g
Crispy Herb Stuffed Tomatoes
freshrusticmediterraneanvegetariancheesecrispytenderweeknight

Ingredients

  • 4 whole large tomatoes
  • 1 cup panko breadcrumbs
  • ¾ cup crumbled feta cheese
  • ½ cup fresh parsley and dill (chopped)
  • ¼ cup red onion (finely diced)
  • 1 whole lemon (zested and juiced)
  • ¼ cup pine nuts or walnuts (roughly chopped)

Instructions

  1. 1

    Heat oven to 400°F. Slice tomatoes in half lengthwise and scoop out the seeds with a spoon, leaving a thin shell.

  2. 2

    Mix breadcrumbs, feta, parsley, dill, onion, lemon zest, juice, nuts, 3 tbsp olive oil, salt, and pepper in a bowl.

  3. 3

    Place tomato halves cut-side up on a sheet pan. Divide the filling evenly among them, packing gently.

  4. 4

    Drizzle the tops with a little more olive oil. Roast for 18–20 minutes until tomato flesh is tender and tops are golden.

  5. 5

    Serve hot or at room temperature, with a squeeze of fresh lemon if desired.

Tools you’ll need

  • sheet pan
  • spoon or melon baller
  • mixing bowl
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.