Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Feta Stuffed Tomatoes

Hollowed tomatoes stuffed with herby breadcrumbs, olives, and feta, then roasted until golden. A Mediterranean dinner that feels fancy but takes 20 minutes.

Total time
20 min
Servings
2
Calories
285
Protein
9g
Crispy Feta Stuffed Tomatoes
elegantlightmediterraneanvegetariancheesecrispytenderweeknight

Ingredients

  • 4 whole large ripe tomatoes
  • ¾ cup crumbled feta cheese
  • ½ cup panko breadcrumbs
  • ⅓ cup kalamata olives, pitted and chopped
  • 3 tbsp fresh parsley, finely chopped
  • 1 tsp lemon zest
  • 3 tbsp olive oil

Instructions

  1. 1

    Heat oven to 400°F. Slice the top off each tomato and scoop out seeds and pulp with a spoon, leaving a 1/4-inch shell.

  2. 2

    Mix feta, panko, olives, parsley, and lemon zest in a bowl until evenly combined.

  3. 3

    Drizzle 1 tbsp olive oil onto a sheet pan. Place hollowed tomatoes cut-side up on the pan.

  4. 4

    Spoon the feta mixture into each tomato, packing gently. Drizzle the remaining 2 tbsp oil over the tops.

  5. 5

    Roast until tomato skin splits slightly and filling is golden brown, 12 to 15 minutes.

  6. 6

    Cool 2 minutes, then serve with a squeeze of fresh lemon juice.

Tools you’ll need

  • sheet pan
  • sharp chef's knife
  • spoon
  • small mixing bowl
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.