CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Ham, Egg & Cheese Bagel

A toasted bagel loaded with crispy ham, melted cheddar, and a fried egg — breakfast that actually fills you up. Serve with refried beans and tortilla chips if you want a full plate.

Total time
12 min
Servings
1
Calories
390
Protein
24g
Crispy Ham, Egg & Cheese Bagel
satisfyingquickamericanegghamcrispymeltyweeknight

Ingredients

  • 1 whole bagel
  • 2 oz ham, sliced
  • 1 slice cheddar cheese
  • 1 whole egg

Instructions

  1. 1

    Split the bagel in half and toast both halves cut-side up in a toaster oven until golden, about 3 minutes.

  2. 2

    Warm the ham in a skillet over medium heat for 1 minute, just until edges start to curl slightly.

  3. 3

    Crack the egg into the same skillet, season with salt and pepper, and fry until whites set but yolk still jiggles, about 3 minutes.

  4. 4

    Lay the cheddar slice on the warm bagel bottom, then stack the ham and fried egg on top.

  5. 5

    Top with the bagel upper half and serve immediately.

Tools you’ll need

  • toaster oven
  • 12-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.