CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Garlic Fish with Dipping Sauce

Whole crispy fish draped in golden garlic and soy-lime sauce—Vietnam's most crave-worthy seafood dinner. Ready in 20 minutes, no fussing required.

Total time
20 min
Servings
2
Calories
485
Protein
52g
Crispy Garlic Fish with Dipping Sauce
casualsatisfyingvietnamesefishcrispyjuicyweeknightdinner

Ingredients

  • 1 fish (1.5 lbs) whole sea bass or snapper, cleaned and scaled
  • 6 cloves garlic, minced
  • 3 tbsp soy sauce
  • 1 whole (juiced) lime
  • 1 tbsp fish sauce
  • ¼ cup all-purpose flour
  • 2 stalks scallion, sliced thin

Instructions

  1. 1

    Pat the fish dry inside and out. Season generously with salt and pepper.

  2. 2

    Toss the fish in flour to coat all over, shaking off excess.

  3. 3

    Heat 3 tbsp oil in a skillet over medium-high until shimmering. Slide the fish in and fry 6 minutes per side without moving, until skin is deep golden and crispy.

  4. 4

    Transfer fish to a plate. In the same skillet, cook garlic over medium for 45 seconds until fragrant, stirring constantly.

  5. 5

    Remove from heat. Stir in soy sauce, fish sauce, and lime juice.

  6. 6

    Pour sauce over the fish. Scatter scallions on top and serve immediately.

Tools you’ll need

  • 12-inch skillet or larger
  • paper towels
  • shallow dish for flour
  • tongs or fish spatula
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.