CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Fried Fish with Herb Sauce & Pickles

Whole fish fried until golden and crispy, served with a bright cilantro-lime dipping sauce, pickled vegetables, and toasted sesame. This Vietnamese classic comes together in under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
42g
Crispy Fried Fish with Herb Sauce & Pickles
casualsatisfyingvietnamesefishcrispyjuicyweeknightdinner

Ingredients

  • 1 fish (about 1.5 lbs) whole fish (sea bream, snapper, or similar), gutted and scaled
  • 1 cup packed fresh cilantro, mint, and scallions
  • 1 whole lime
  • 2 tbsp fish sauce
  • ¾ cup quick-pickled vegetables (carrot, daikon, or cucumber)
  • 2 tbsp sesame seeds, white or black

Instructions

  1. 1

    Pat the fish dry inside and out with paper towels. Score the skin with a sharp knife in a crosshatch pattern.

  2. 2

    Heat neutral oil in a large skillet or wok to 350°F (a pinch of flour should sizzle immediately when dropped in).

  3. 3

    Carefully slide the fish into the hot oil and fry without moving for 6–8 minutes until the skin is deep golden and crispy.

  4. 4

    Gently flip and fry the second side for 4–5 minutes until golden. The flesh should flake easily when pierced.

  5. 5

    Chop cilantro, mint, and scallions together. Whisk with lime juice, fish sauce, and 2 tbsp water to make the dipping sauce.

  6. 6

    Transfer fish to a serving plate. Sprinkle with sesame seeds, salt, and black pepper. Serve with sauce, pickled vegetables, and extra herbs.

Tools you’ll need

  • large skillet or wok, 12+ inches
  • paper towels
  • sharp knife
  • instant-read thermometer (optional but helpful)
  • wide spatula or fish turner
  • small bowl for sauce
  • whisk or spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Vietnamese recipes →