CookSnap is coming soon — Join the waitlist →

Crispy Fried Fish with Green Sauce & Pickled Carrots

Whole fish fried until golden and crunchy outside, tender inside, served with a vibrant herb-based dipping sauce and quick-pickled carrots. Pure Vietnamese street food simplicity.

Total time
20 min
Servings
2
Calories
520
Protein
42g
Crispy Fried Fish with Green Sauce & Pickled Carrots
casualsatisfyingvietnamesefishcrispytenderweeknightdinner

Ingredients

  • 2 whole (12 oz each) whole fish (sea bream, tilapia, or sea bass), cleaned and gutted
  • 1 medium carrots, thinly sliced
  • 3 tbsp white vinegar
  • ½ cup mixed fresh cilantro, mint, and dill, chopped
  • 2 tbsp lime juice
  • 2 tbsp fish sauce

Instructions

  1. 1

    Toss sliced carrots with 3 tbsp vinegar, 1 tbsp water, and a pinch of salt. Let sit while you prep.

  2. 2

    Pat both fish dry inside and out. Season generously with salt and pepper inside the cavity and on the skin.

  3. 3

    Heat 1.5 inches of neutral oil in a deep skillet or wok to 350°F. Test: a piece of bread browns in 60 seconds.

  4. 4

    Slide one fish into the hot oil, fry 5-6 minutes per side without moving until skin is deep golden and crispy.

  5. 5

    Repeat with the second fish. Transfer both to a paper-towel-lined plate to drain.

  6. 6

    Mix chopped herbs, 2 tbsp lime juice, and 2 tbsp fish sauce in a small bowl to make the dipping sauce.

  7. 7

    Serve whole fried fish with pickled carrots alongside and herb sauce for dipping.

Tools you’ll need

  • deep skillet or wok, 12-inch minimum
  • instant-read thermometer
  • tongs or slotted spatula
  • paper towels
  • small mixing bowl
  • cutting board and knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.