CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Farro & Roasted Veggie Bowl

Nutty farro tossed with charred tomatoes, zucchini, and bell peppers, finished with garlicky olive oil and fresh basil. A warm, hearty Italian bowl that's ready in under 30 minutes.

Total time
28 min
Servings
2
Calories
385
Protein
12g
Crispy Farro & Roasted Veggie Bowl
wholesomesatisfyingitalianvegetarianvegetarianchewycrispytender

Ingredients

  • 1 cup farro
  • 1.5 cups cherry tomatoes, halved
  • 1 medium zucchini, cut into 1-inch chunks
  • 1 red bell pepper, chopped into 1-inch pieces
  • 3 cloves garlic, minced
  • ⅓ cup fresh basil, chopped
  • 4 tbsp olive oil

Instructions

  1. 1

    Boil farro in salted water for 20 minutes until tender but still chewy. Drain and set aside.

  2. 2

    While farro cooks, toss zucchini, bell pepper, and tomatoes with 2 tbsp olive oil and a pinch of salt.

  3. 3

    Spread vegetables on a sheet pan and roast at 425°F for 12 minutes, stirring halfway through, until charred at edges.

  4. 4

    Heat remaining 2 tbsp olive oil in a small skillet over medium heat. Add minced garlic and cook 30 seconds until fragrant.

  5. 5

    Toss cooked farro with roasted vegetables, garlic oil, and half the fresh basil. Season with salt and pepper to taste.

  6. 6

    Divide into bowls and top with remaining basil. Serve warm.

Tools you’ll need

  • large pot
  • sheet pan
  • small skillet
  • cutting board
  • chef's knife
  • wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Italian recipes →