CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Farro & Roasted Veg Bowl

Nutty farro paired with charred zucchini, bell peppers, and cherry tomatoes, finished with a bright lemon-garlic drizzle. One-pan roast, then toss together for a weeknight Italian dinner that feels restaurant-quality.

Total time
28 min
Servings
2
Calories
485
Protein
15g
Crispy Farro & Roasted Veg Bowl
freshwholesomeitalianvegetarianvegetariancrispytenderchewy

Ingredients

  • 1 cup farro
  • 1 medium zucchini, cut into 1-inch chunks
  • 1 large red or yellow bell pepper, cut into 1-inch chunks
  • 1.5 cups cherry tomatoes
  • 1 whole lemon (zested + juiced)
  • 1.5 tsp dried oregano
  • ¼ tsp red pepper flakes

Instructions

  1. 1

    Boil farro in salted water until tender and chewy, about 20 minutes. Drain and set aside.

  2. 2

    While farro cooks, toss zucchini, bell pepper, and cherry tomatoes with 2 tbsp olive oil, salt, and pepper on a sheet pan.

  3. 3

    Roast at 425°F until vegetables are charred and tender, stirring halfway through, about 15 minutes.

  4. 4

    Whisk together lemon juice, lemon zest, minced garlic, oregano, and red pepper flakes with 2 tbsp olive oil.

  5. 5

    Toss warm farro with roasted vegetables, then drizzle with lemon-garlic dressing and toss to coat.

  6. 6

    Divide between bowls and serve warm or at room temperature.

Tools you’ll need

  • large pot
  • sheet pan
  • small mixing bowl
  • wooden spoon
  • serving spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.