CookSnap is coming soon — Join the waitlist →
Back to recipes

Mediterranean Bowl

Warm grain bowl with roasted vegetables, chickpeas, and a bright lemon-tahini dressing. Ready in 25 minutes and fully customizable with pantry staples.

Total time
25 min
Servings
2
Calories
385
Protein
13g
Mediterranean Bowl
freshwholesomesimplemediterraneanvegetarianveganchickpeascrispy

Ingredients

  • 1.5 cups cooked quinoa or rice
  • 1 can (15 oz) canned chickpeas, drained and rinsed
  • 8 oz cherry tomatoes
  • 1 medium cucumber
  • ¼ medium red onion
  • 2 tbsp tahini
  • 1 whole lemon (juiced)

Instructions

  1. 1

    Halve the cherry tomatoes. Slice the cucumber into thin rounds. Dice the red onion finely.

  2. 2

    Pat the chickpeas dry with a kitchen towel. Toss with 1 tbsp olive oil, salt, and pepper.

  3. 3

    Spread chickpeas on a sheet pan. Roast at 425°F until crispy and browned, ~12 minutes.

  4. 4

    While chickpeas roast, whisk tahini with lemon juice, 2 tbsp water, salt, and pepper until smooth.

  5. 5

    Divide quinoa between two bowls. Top with roasted chickpeas, tomatoes, cucumber, and red onion.

  6. 6

    Drizzle tahini dressing over the bowl. Serve immediately.

Tools you’ll need

  • sheet pan
  • kitchen towel
  • small bowl
  • whisk
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.