5-Min Crispy Corn Dog Bites
Hot dogs coated in a simple cornbread batter and fried until golden and crispy on the outside. Ready in under 5 minutes—a weeknight snack or quick dinner that's pure comfort food.
- Total time
- 5 min
- Servings
- 4
- Calories
- 385
- Protein
- 10g
comfortcasualamericanbeefcrispytenderweeknightgame-day
Ingredients
- 8 whole hot dogs
- 1 box (8.5 oz) cornbread mix
- 1 whole egg
- ¾ cup milk
Instructions
- 1
Cut hot dogs into 1-inch bite-sized pieces.
- 2
Stir cornbread mix, egg, and milk in a bowl until smooth.
- 3
Heat 2 inches of oil in a deep skillet over medium-high until a drop of batter sizzles instantly.
- 4
Dip each hot dog piece into the batter, then carefully slide into the hot oil in batches.
- 5
Fry until golden brown on all sides, about 90 seconds, turning occasionally with a fork.
- 6
Transfer to a paper towel–lined plate and serve hot.
Tools you’ll need
- cutting board
- knife
- mixing bowl
- deep skillet (10-inch or larger)
- fork or slotted spoon
- paper towels
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
