Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Chili Avocado Toast

Ripe avocado smashed on sourdough with chili crisp, everything seasoning, and a crack of fleur de sel. Ready in 5 minutes—pure TikTok gold.

Total time
5 min
Servings
2
Calories
310
Protein
9g
Crispy Chili Avocado Toast
freshquickcalifornianvegetarianvegancreamycrispyweeknight

Ingredients

  • 2 slices sourdough bread
  • 1 whole ripe avocado
  • 1 tbsp chili crisp (Lao Gan Ma or similar)
  • ½ tsp everything bagel seasoning
  • ½ whole lemon
  • 1 pinch fleur de sel or maldon salt

Instructions

  1. 1

    Toast the sourdough until the edges turn golden and the surface is crispy, 2–3 minutes.

  2. 2

    Halve the avocado, scoop the flesh into a bowl, and mash with a fork until chunky.

  3. 3

    Squeeze the lemon half into the mash and stir gently. Season with a pinch of salt and pepper.

  4. 4

    Spread the avocado evenly across both toasted slices.

  5. 5

    Drizzle 1 tbsp chili crisp over each slice, then sprinkle with everything bagel seasoning.

  6. 6

    Finish with a tiny pinch of fleur de sel. Serve immediately.

Tools you’ll need

  • toaster
  • small bowl
  • fork
  • butter knife or offset spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.