Crispy Chili Avocado Toast
Ripe avocado smashed on sourdough with chili crisp, everything seasoning, and a crack of fleur de sel. Ready in 5 minutes—pure TikTok gold.
- Total time
- 5 min
- Servings
- 2
- Calories
- 310
- Protein
- 9g

freshquickcalifornianvegetarianvegancreamycrispyweeknight
Ingredients
- 2 slices sourdough bread
- 1 whole ripe avocado
- 1 tbsp chili crisp (Lao Gan Ma or similar)
- ½ tsp everything bagel seasoning
- ½ whole lemon
- 1 pinch fleur de sel or maldon salt
Instructions
- 1
Toast the sourdough until the edges turn golden and the surface is crispy, 2–3 minutes.
- 2
Halve the avocado, scoop the flesh into a bowl, and mash with a fork until chunky.
- 3
Squeeze the lemon half into the mash and stir gently. Season with a pinch of salt and pepper.
- 4
Spread the avocado evenly across both toasted slices.
- 5
Drizzle 1 tbsp chili crisp over each slice, then sprinkle with everything bagel seasoning.
- 6
Finish with a tiny pinch of fleur de sel. Serve immediately.
Tools you’ll need
- toaster
- small bowl
- fork
- butter knife or offset spatula
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

