Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Chicken Schnitzel with Roasted Potatoes & Salad

Golden-fried thin chicken cutlets with herb-seasoned roasted potatoes and fresh green salad. Restaurant-quality schnitzel that comes together in under 30 minutes.

Total time
28 min
Servings
2
Calories
640
Protein
48g
Crispy Chicken Schnitzel with Roasted Potatoes & Salad
satisfyingsimpleisraelichickencrispytenderjuicySalad

Ingredients

  • 2 pieces (about 1 lb) boneless, skinless chicken breasts
  • ½ cup all-purpose flour
  • 2 pieces eggs
  • ¾ cup panko breadcrumbs
  • 1 lb baby potatoes, halved
  • 2 pieces fresh lemon
  • 3 cups mixed greens or romaine

Instructions

  1. 1

    Place potatoes on a sheet pan, drizzle with 2 tbsp oil, salt, and pepper. Roast at 425°F for 20 minutes until golden and tender.

  2. 2

    Pound chicken breasts between plastic wrap until 1/4-inch thick. Season both sides generously with salt and pepper.

  3. 3

    Set up three shallow bowls: flour in the first, beaten eggs in the second, panko mixed with 1 tsp dried oregano in the third.

  4. 4

    Coat each chicken piece in flour, shake off excess, dip in egg, then coat fully with panko, pressing gently so it adheres.

  5. 5

    Heat 3 tbsp oil in a large skillet over medium-high until it shimmers, about 90 seconds. Fry chicken 3–4 minutes per side until golden brown and cooked through.

  6. 6

    Toss greens with juice of 1 lemon, 1 tbsp oil, salt, and pepper. Plate schnitzel, potatoes, salad, and lemon wedges.

Tools you’ll need

  • sheet pan
  • large skillet (12-inch)
  • plastic wrap
  • meat mallet
  • three shallow bowls
  • tongs
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.