CookSnap is coming soon — Join the waitlist →

20-Min Crispy Chicken Pot Pie

A Brazilian-inspired handheld chicken pot pie with buttery pastry crust and creamy chicken filling, cooked in one skillet in under 20 minutes. Flaky, comforting, and perfect for weeknight dinner.

Total time
20 min
Servings
2
Calories
580
Protein
38g
20-Min Crispy Chicken Pot Pie
comfortbrazilianchickencrispytendercreamyflakyweeknight

Ingredients

  • 2 cups rotisserie chicken, shredded
  • 3 tbsp butter
  • 1 cup frozen peas and carrots
  • ¾ cup chicken broth
  • 2 tbsp all-purpose flour
  • 1 sheet (9 oz) puff pastry sheets, thawed
  • 1 pinch salt and pepper

Instructions

  1. 1

    Melt butter in a 10-inch skillet over medium heat until foamy, about 1 minute.

  2. 2

    Sprinkle flour into the butter and stir constantly for 90 seconds until it turns light golden brown.

  3. 3

    Pour broth slowly while whisking to prevent lumps, then add shredded chicken, peas, and carrots with salt and pepper.

  4. 4

    Simmer for 4 minutes, stirring occasionally, until sauce thickens and coats the back of a spoon.

  5. 5

    Drape thawed puff pastry over the filling, tucking edges down slightly so they don't burn.

  6. 6

    Bake at 400°F for 8–10 minutes until pastry is golden brown and puffed, then serve hot.

Tools you’ll need

  • 10-inch cast iron or nonstick skillet
  • whisk
  • wooden spoon
  • oven (or toaster oven)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.