CookSnap is coming soon — Join the waitlist →
Back to recipes

Chicken Empada Skillet

Crispy-bottomed Brazilian chicken pie made in one skillet with a buttery, savory filling and a golden pastry crust. No rolling required—just press, fill, and bake.

Total time
25 min
Servings
4
Calories
520
Protein
22g
Chicken Empada Skillet
comfortsatisfyingbrazilianchickencrispytenderflakyweeknight

Ingredients

  • 1.5 cups rotisserie chicken, shredded
  • 1.5 cups all-purpose flour
  • ½ cup butter, cold, cubed
  • ½ cup green olives, pitted and halved
  • 1 whole egg (for filling)
  • 1 whole egg (for egg wash)
  • ½ cup palm hearts (or canned corn), drained

Instructions

  1. 1

    Mix flour, 0.5 tsp salt, and 0.25 tsp black pepper in a bowl. Cut in cold butter until texture resembles coarse breadcrumbs, ~3 min.

  2. 2

    Add 4 tbsp ice water and stir until dough just holds together. Press into a 10-inch cast iron skillet, covering bottom and sides.

  3. 3

    Mix shredded chicken, olives, palm hearts, 1 egg, and a pinch of salt in a separate bowl. Spread filling evenly over crust.

  4. 4

    Beat the remaining egg with 1 tbsp water. Brush over crust edges until glossy.

  5. 5

    Bake at 400°F until crust is deep golden brown and filling is hot, 12–15 minutes.

  6. 6

    Cool 2 minutes in the skillet. Slice into wedges and serve warm.

Tools you’ll need

  • 10-inch cast iron skillet
  • mixing bowl
  • fork or pastry cutter
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.