CookSnap is coming soon — Join the waitlist →

Crispy Chicken Parm Sandwich with Fries

Panko-breaded chicken breast, fast-fried until golden, topped with marinara and melted mozzarella on crispy ciabatta. Serve with oven fries and a quick dipping sauce for the ultimate crispy-cutlet sandwich.

Total time
20 min
Servings
2
Calories
680
Protein
48g
Crispy Chicken Parm Sandwich with Fries
comfortindulgentitalianchickencrispytendermeltyweeknight

Ingredients

  • 2 ea chicken breasts, boneless skinless
  • ½ cup panko breadcrumbs
  • ¾ cup marinara sauce
  • 4 oz fresh mozzarella or provolone, sliced
  • 2 ea ciabatta rolls
  • 1 bag (10 oz) frozen french fries

Instructions

  1. 1

    Start the fries according to package directions in a separate oven or air fryer.

  2. 2

    Pound each chicken breast to 1/4-inch thickness between plastic wrap with a meat mallet.

  3. 3

    Mix panko with salt and pepper on a shallow plate. Coat both sides of chicken, pressing gently.

  4. 4

    Heat 3 tablespoons oil in a large skillet over medium-high until shimmering, about 60 seconds.

  5. 5

    Sear chicken 3–4 minutes per side without moving. Edges should turn golden and meat should feel firm.

  6. 6

    Top each cutlet with 3 tablespoons marinara and 2 oz mozzarella. Cover and cook 2 minutes until cheese melts.

  7. 7

    Toast ciabatta rolls cut-side down in the same skillet 1 minute until lightly golden.

  8. 8

    Build sandwiches: place chicken on roll bottoms, close with tops. Serve with fries and marinara for dipping.

Tools you’ll need

  • large skillet (12-inch)
  • meat mallet
  • shallow plate
  • oven or air fryer (for fries)
  • tongs or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.