CookSnap is coming soon — Join the waitlist →

Crispy Chicken Parm Sandwich

Crispy breaded chicken cutlet topped with melted mozzarella, marinara, and fresh arugula on toasted ciabatta. Ready in 15 minutes with a single skillet.

Total time
15 min
Servings
2
Calories
620
Protein
42g
Crispy Chicken Parm Sandwich
casualsatisfyingitalianchickencrispymeltytenderweeknight

Ingredients

  • 2 breasts (about 6 oz each) boneless, skinless chicken breasts
  • ½ cup all-purpose flour
  • 1 large egg
  • ¾ cup panko breadcrumbs
  • ½ cup marinara sauce
  • 4 oz (about 1 cup shredded) fresh mozzarella or low-moisture mozzarella
  • 1 loaf or 2 individual rolls ciabatta roll or 2 ciabatta rolls
  • 1 cup fresh arugula
  • 2 tbsp mayonnaise

Instructions

  1. 1

    Place chicken breasts between plastic wrap and pound to 0.5-inch thickness with a meat mallet.

  2. 2

    Set up three shallow bowls: flour in the first, beaten egg in the second, panko mixed with salt and pepper in the third.

  3. 3

    Coat each chicken breast in flour, shaking off excess, then dip in egg, then coat thoroughly with panko.

  4. 4

    Heat oil in a 12-inch skillet over medium-high heat until it shimmers, about 90 seconds.

  5. 5

    Pan-fry chicken 3-4 minutes per side without moving until golden brown and cooked through.

  6. 6

    Top each piece with marinara sauce and mozzarella, cover with a lid, and cook 1-2 minutes until cheese melts.

  7. 7

    Slice ciabatta and lightly toast, then spread mayo on both sides.

  8. 8

    Build sandwiches: toast, arugula, chicken, top bun. Serve immediately.

Tools you’ll need

  • 12-inch stainless steel or non-stick skillet
  • meat mallet
  • plastic wrap
  • three shallow bowls
  • tongs
  • lid or aluminum foil
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.