Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Chicken in Cream Sauce with Vegetables

Golden crispy chicken pieces simmered in a rich cream sauce with a colorful mix of vegetables. A quick and satisfying weeknight dinner.

Total time
25 min
Servings
4
Calories
520
Protein
38g
Crispy Chicken in Cream Sauce with Vegetables
comfortingAmericangluten-freechickencrispycreamyweeknightmain course

Ingredients

  • 1.5 lb chicken breast
  • 2 cup broccoli florets
  • 1.5 cup frozen mixed vegetables
  • 1 cup heavy cream
  • ½ cup chicken broth
  • 2 tbsp olive oil

Instructions

  1. 1

    Cut the 1.5 lb chicken breast into bite-sized pieces and season with salt and pepper. Heat 2 tbsp olive oil in a large skillet over medium-high heat.

  2. 2

    Add the chicken in a single layer and cook until golden and crispy on all sides, about 6-8 minutes. Remove from skillet and set aside.

  3. 3

    In the same skillet, add 2 cups broccoli florets and 1.5 cups frozen mixed vegetables. Sauté for 3-4 minutes until slightly tender.

  4. 4

    Pour in 1 cup heavy cream and 0.5 cup chicken broth. Stir and bring to a simmer, scraping up any browned bits.

  5. 5

    Return the chicken to the skillet and simmer for 3-4 minutes until the sauce thickens and the chicken is cooked through. Serve hot.

Tools you’ll need

  • large skillet
  • cutting board
  • knife
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.