Crispy Cheesy Skillet Hash Browns
Golden, crispy hash browns loaded with melted cheddar cheese and butter. A simple weeknight breakfast that's ready in 15 minutes and tastes like a diner favorite.
- Total time
- 15 min
- Servings
- 2
- Calories
- 380
- Protein
- 8g
comfortsimpleamericanvegetariancrispymeltyweeknightbreakfast
Ingredients
- 3 cups frozen hash browns
- 3 tbsp butter
- 1 cup cheddar cheese, shredded
Instructions
- 1
Melt butter in a 10-inch skillet over medium-high heat until foaming.
- 2
Add frozen hash browns and cook without stirring for 4 minutes until bottom edges turn golden.
- 3
Stir the hash browns, breaking up clumps, then spread in an even layer.
- 4
Cook 4 more minutes until all sides are crispy and brown.
- 5
Scatter cheddar over the top and cook 1 minute until cheese melts and gets slightly browned.
- 6
Serve hot directly from the skillet.
Tools you’ll need
- 10-inch skillet or cast iron pan
- spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
