Custrd is out on the App Store — Download it free →
Back to recipes

15-Min Crispy Cheese Pogácsa

Hungarian cheese pastry puffs — buttery, crispy, and ready in 15 minutes using puff pastry and a sheet pan. Savory, satisfying, and perfect for snacking or a light dinner.

Total time
15 min
Servings
4
Calories
312
Protein
9g
15-Min Crispy Cheese Pogácsa
casualcomforthungarianvegetariancheesecrispyflakytender

Ingredients

  • 1 sheet (9.2 oz) thawed puff pastry
  • 1 cup (4 oz) sharp cheddar, grated
  • ¼ cup sour cream
  • 1 tsp caraway seeds
  • ½ tsp paprika (sweet or hot)
  • 1 whole egg, beaten

Instructions

  1. 1

    Heat oven to 400°F. Line a sheet pan with parchment paper.

  2. 2

    Mix grated cheddar, sour cream, caraway seeds, and paprika in a bowl until combined.

  3. 3

    Lay puff pastry on the prepared pan. Spread cheese mixture evenly over the entire sheet.

  4. 4

    Brush the top with beaten egg until the surface looks glossy.

  5. 5

    Bake for 10 minutes until the pastry is golden brown and the edges puff up.

  6. 6

    Cool for 2 minutes, then cut into 12 rectangles or squares and serve warm.

Tools you’ll need

  • sheet pan
  • parchment paper
  • small bowl
  • pastry brush
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.