15-Min Crispy Cheese Pogácsa
Hungarian cheese pastry puffs — buttery, crispy, and ready in 15 minutes using puff pastry and a sheet pan. Savory, satisfying, and perfect for snacking or a light dinner.
- Total time
- 15 min
- Servings
- 4
- Calories
- 312
- Protein
- 9g
casualcomforthungarianvegetariancheesecrispyflakytender
Ingredients
- 1 sheet (9.2 oz) thawed puff pastry
- 1 cup (4 oz) sharp cheddar, grated
- ¼ cup sour cream
- 1 tsp caraway seeds
- ½ tsp paprika (sweet or hot)
- 1 whole egg, beaten
Instructions
- 1
Heat oven to 400°F. Line a sheet pan with parchment paper.
- 2
Mix grated cheddar, sour cream, caraway seeds, and paprika in a bowl until combined.
- 3
Lay puff pastry on the prepared pan. Spread cheese mixture evenly over the entire sheet.
- 4
Brush the top with beaten egg until the surface looks glossy.
- 5
Bake for 10 minutes until the pastry is golden brown and the edges puff up.
- 6
Cool for 2 minutes, then cut into 12 rectangles or squares and serve warm.
Tools you’ll need
- sheet pan
- parchment paper
- small bowl
- pastry brush
- chef's knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
