CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Boondi Ladoo

Golden, crunchy gram flour pearls rolled in cardamom-spiked sugar syrup and finished with toasted nuts. A 20-minute Indian sweet that's crispy outside, chewy within.

Total time
20 min
Servings
4
Calories
380
Protein
6g
Crispy Boondi Ladoo
indulgentcelebratoryindianvegetarianegg-freedairy-freecrispychewy

Ingredients

  • 1 cup gram flour (besan)
  • 1.5 cups neutral cooking oil
  • ¾ cup granulated sugar
  • ½ cup water
  • 6 pods green cardamom pods, crushed
  • ¼ cup roasted cashews, halved
  • 3 tablespoons roasted raisins

Instructions

  1. 1

    Heat oil in a heavy skillet over medium-high until a drop of batter sizzles on contact, about 90 seconds.

  2. 2

    Pour gram flour into a squeeze bottle. Drizzle thin streams into hot oil, creating pea-sized pearls; fry 2 minutes until light golden.

  3. 3

    Drain boondi on a paper-towel-lined plate, letting excess oil drip off.

  4. 4

    In a small saucepan, combine sugar, water, and crushed cardamom. Bring to a boil, stirring, then simmer 3 minutes until syrup thickens slightly.

  5. 5

    Pour warm syrup over cooled boondi, stirring gently to coat every pearl without crushing them.

  6. 6

    Fold in cashews and raisins. Let rest 2 minutes for ladoos to set, then serve at room temperature or chilled.

Tools you’ll need

  • heavy-bottomed skillet (12-inch)
  • squeeze bottle or piping bag
  • paper towels
  • small saucepan
  • wooden spoon
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.