CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Banana Fritters

Golden, caramelized banana fritters coated in a light rice-flour batter and fried until edges curl. Served warm with a sweet drizzle, these are pure Vietnamese comfort in under 25 minutes.

Total time
25 min
Servings
2
Calories
420
Protein
3g
Crispy Banana Fritters
indulgentcomfortvietnamesevegetariandairy-freecrispysoftweeknight

Ingredients

  • 3 medium ripe bananas
  • ½ cup rice flour
  • ¼ cup tapioca starch
  • ½ cup sparkling water or club soda
  • 2 cups neutral cooking oil for frying
  • ¼ cup sweetened condensed milk

Instructions

  1. 1

    Peel bananas and slice them diagonally into 0.5-inch-thick pieces.

  2. 2

    Whisk rice flour, tapioca starch, and a pinch of salt in a bowl until combined.

  3. 3

    Pour sparkling water into the flour mixture and stir until you have a thin, smooth batter with no lumps.

  4. 4

    Heat oil in a deep skillet to 350°F (175°C) — water flicked into the pan should sizzle immediately without smoking.

  5. 5

    Working in batches, dip banana slices into batter, tap off excess, and slide into hot oil. Fry 2–3 minutes per side until deep golden brown and edges curl slightly.

  6. 6

    Lift fritters onto a paper towel. Drizzle warm condensed milk over the top and serve immediately.

Tools you’ll need

  • medium bowl
  • whisk
  • deep skillet or heavy pot
  • instant-read thermometer
  • slotted spoon or spider strainer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.