Creamy Mushroom Tortellini Skillet
Tender tortellini, sautéed mushrooms, and fresh asparagus tossed in a silky cream sauce in one skillet, ready in 15 minutes. Pure comfort, zero fuss.
- Total time
- 15 min
- Servings
- 2
- Calories
- 520
- Protein
- 18g
comfortsimpleitalianvegetarianvegetariancreamytenderweeknight
Ingredients
- 1 lb tortellini
- 8 oz mushrooms, sliced
- 8 oz asparagus, cut into 2-inch pieces
- 1 cup heavy cream
Instructions
- 1
Boil salted water in a large skillet, add tortellini, and cook until they float, about 4 minutes.
- 2
Push tortellini to the side, add mushrooms and asparagus to the skillet with a splash of oil.
- 3
Sauté until mushrooms soften and asparagus turns bright green, about 4 minutes.
- 4
Pour cream over everything, stir gently until tortellini coats, season with salt and pepper to taste.
- 5
Warm through for 1 minute, then serve hot.
Tools you’ll need
- large skillet
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
