CookSnap is coming soon — Join the waitlist →

Creamy Gorgonzola Gnocchi

Pillowy potato gnocchi tossed in a silky blue cheese sauce with butter and cream. Ready in under 20 minutes — the ultimate comfort pasta.

Total time
18 min
Servings
2
Calories
628
Protein
18g
Creamy Gorgonzola Gnocchi
comfortindulgentitalianvegetarianvegetariancreamytenderweeknight

Ingredients

  • 1 lb store-bought potato gnocchi
  • 4 oz gorgonzola or other creamy blue cheese, crumbled
  • ½ cup heavy cream
  • 3 tbsp butter
  • 6 leaves fresh sage leaves (or parsley), torn
  • ¼ cup walnuts, lightly toasted and chopped

Instructions

  1. 1

    Bring a large pot of salted water to a boil. Add gnocchi and cook until they float, then 1 minute more.

  2. 2

    Reserve 0.5 cup pasta water, then drain gnocchi into a colander.

  3. 3

    In a large skillet, melt butter over medium heat. Add cream and bring to a gentle simmer.

  4. 4

    Add gorgonzola to the skillet, stirring constantly until melted and smooth, about 2 minutes.

  5. 5

    Add cooked gnocchi and 0.25 cup pasta water to the sauce. Toss gently until coated, adding more water if needed.

  6. 6

    Plate immediately. Top with sage, walnuts, cracked black pepper, and a pinch of salt.

Tools you’ll need

  • large pot
  • colander
  • large skillet (12-inch)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.