Custrd is out on the App Store — Download it free →
Back to recipes

20-Min Creamy Chicken Empadão

Brazilian chicken hand pie, reimagined as a quick skillet filling with puff pastry. Creamy, savory, ready in 20 minutes—no rolling dough required.

Total time
20 min
Servings
4
Calories
520
Protein
32g
20-Min Creamy Chicken Empadão
comfortcasualbrazilianchickencreamyflakytenderweeknight

Ingredients

  • 2 cups rotisserie chicken, shredded
  • 4 oz cream cheese
  • 1 cup frozen peas and carrots
  • ¾ cup cheddar cheese, shredded
  • 1 box (2 sheets) puff pastry sheets, thawed
  • 1 whole egg (for wash)
  • 2 tbsp fresh cilantro or parsley, chopped

Instructions

  1. 1

    Heat a 10-inch skillet over medium. Add cream cheese and let it soften, stirring occasionally, about 90 seconds.

  2. 2

    Stir in shredded chicken, frozen peas and carrots, and cheddar. Cook until vegetables are warm and cheese melts, ~3 minutes.

  3. 3

    Transfer filling to a shallow baking dish or leave in skillet if oven-safe. Season with salt and pepper to taste.

  4. 4

    Unfold puff pastry sheets and lay over filling, pressing edges down gently. Whisk egg and brush over pastry.

  5. 5

    Broil on high for 4–5 minutes until pastry is golden brown and puffed. Watch carefully to avoid burning.

  6. 6

    Remove from heat. Scatter cilantro over top and let rest 2 minutes. Serve warm.

Tools you’ll need

  • 10-inch skillet
  • shallow baking dish (or oven-safe skillet)
  • broiler
  • small bowl (for egg wash)
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.