Cottage Cheese Toast with Honey
Creamy cottage cheese spread on warm toast, drizzled with honey and topped with a pinch of flaky salt. A simple, protein-rich breakfast that's ready in minutes.
- Total time
- 10 min
- Servings
- 2
- Calories
- 215
- Protein
- 12g

simplefreshvegetariancheesecreamycrispyweeknightbrunch
Ingredients
- 2 slices bread (sourdough or whole grain)
- ¾ cup cottage cheese
- 2 tbsp honey
- ¼ tsp flaky sea salt
- 1 pinch black pepper
Instructions
- 1
Toast bread until golden brown and crispy on both sides.
- 2
Spread 1/3 cup cottage cheese evenly onto each warm slice of toast.
- 3
Drizzle 1 tbsp honey over each toast.
- 4
Sprinkle salt and black pepper over the top. Serve immediately.
Tools you’ll need
- toaster or toaster oven
- knife
- small spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



