CookSnap is coming soon — Join the waitlist →
Back to recipes

Com Rang Thap Cam — Mixed Fried Rice with Lime

Vietnamese mixed fried rice loaded with egg, shrimp, and char-edged rice, finished with a squeeze of lime and crisp cucumber. Fast, savory, and completely crave-able in under 20 minutes.

Total time
18 min
Servings
2
Calories
380
Protein
18g
Com Rang Thap Cam — Mixed Fried Rice with Lime
quicksatisfyingvietnameseshrimpeggscrispytenderweeknight

Ingredients

  • 2 cups cooked white rice, preferably day-old and chilled
  • 5 oz shrimp, peeled and deveined
  • 2 whole eggs
  • 2 tbsp soy sauce
  • ½ whole cucumber, sliced into thin rounds
  • 1 whole lime

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  2. 2

    Add shrimp and cook without stirring for 90 seconds until starting to pink on the bottom.

  3. 3

    Stir and cook shrimp another 60 seconds until fully opaque, then push to the side of the skillet.

  4. 4

    Crack eggs into the cleared space and scramble until just set, about 90 seconds.

  5. 5

    Add rice, breaking up clumps, then pour soy sauce over and toss everything together until heated through, 2–3 minutes.

  6. 6

    Serve hot with sliced cucumber on the side and a lime wedge for squeezing.

Tools you’ll need

  • 14-inch skillet or wok
  • spatula
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Vietnamese recipes →