CookSnap is coming soon — Join the waitlist →
Back to recipes

Com Rang Thap Cam — Mixed Fried Rice with Crispy Egg

Vietnamese mixed fried rice studded with shrimp, ham, and peas, topped with a crispy fried egg and served with cucumber, tomato, and a savory dipping sauce. Total flavor and texture in under 20 minutes.

Total time
18 min
Servings
2
Calories
485
Protein
28g
Com Rang Thap Cam — Mixed Fried Rice with Crispy Egg
satisfyingquickvietnameseshrimpeggscrispyfluffyweeknight

Ingredients

  • 3 cups cooked white rice (day-old, broken into grains)
  • ½ lb shrimp, chopped
  • ½ cup diced ham or bacon
  • ½ cup frozen peas
  • 2 whole eggs
  • 2 tbsp fish sauce
  • 2 whole scallions (white and green parts), sliced
  • 1 whole lime (for serving)

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over high heat. When shimmering, add shrimp and ham; cook 2 minutes until shrimp turns pink.

  2. 2

    Add rice and peas, breaking up clumps with a spoon. Stir constantly until rice separates and grains are lightly golden, 3 minutes.

  3. 3

    Pour fish sauce over the rice. Toss until evenly coated. Add scallions and stir for 30 seconds until fragrant.

  4. 4

    Transfer fried rice to a plate. Add 1 tbsp oil to the skillet and crack both eggs into it. Fry until whites set but yolks still jiggle.

  5. 5

    Slide the crispy-edged eggs onto the rice. Serve with lime wedges, cucumber slices, and tomato wedges on the side.

Tools you’ll need

  • large skillet (12-inch)
  • spoon or spatula
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.