CookSnap is coming soon — Join the waitlist →

Cold Buckwheat Noodle Bowl

Chewy buckwheat noodles chilled and served in a tangy, lightly spiced broth with cucumber and a soft-boiled egg. Ready in 15 minutes—authentic Korean comfort that tastes like summer.

Total time
15 min
Servings
2
Calories
320
Protein
12g
Cold Buckwheat Noodle Bowl
refreshinglightkoreanvegetarianeggschewycrispyweeknight

Ingredients

  • 8 oz buckwheat noodles (soba or mak guksu)
  • 2.5 cups vegetable broth or dashi
  • ½ tsp gochugaru (Korean red chili flakes)
  • 2 tbsp soy sauce
  • ½ whole cucumber
  • 2 whole eggs

Instructions

  1. 1

    Bring a pot of salted water to a boil. Add buckwheat noodles and cook until tender, about 5 minutes.

  2. 2

    While noodles cook, bring a small pot of water to boil. Gently add eggs and cook for 6 minutes, then transfer to ice water.

  3. 3

    Drain noodles and rinse under cold running water until completely chilled, about 1 minute.

  4. 4

    Stir broth with gochugaru and soy sauce. Chill in the fridge or add ice cubes to cool quickly.

  5. 5

    Slice cucumber into thin matchsticks. Peel and halve the soft-boiled eggs.

  6. 6

    Divide noodles between two bowls, pour chilled broth over top, then arrange cucumber and egg on each.

Tools you’ll need

  • large pot
  • small pot
  • colander
  • two bowls
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.