CookSnap is coming soon — Join the waitlist →
Back to recipes

Chilled Buckwheat Noodle Bowl

Korean-style cold buckwheat noodles with a tangy dipping sauce, topped with fresh vegetables and a soft-boiled egg. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
380
Protein
14g
Chilled Buckwheat Noodle Bowl
refreshinglightkoreanvegetarianeggschewycrispyweeknight

Ingredients

  • 300 g buckwheat noodles (soba or mak guksu)
  • 3 tbsp soy sauce
  • 2 tbsp rice vinegar
  • 1 tbsp gochujang (Korean red chili paste)
  • 2 whole eggs
  • ½ whole cucumber, seedless

Instructions

  1. 1

    Bring a pot of water to a boil. Add buckwheat noodles and stir to separate, then cook until tender, about 4–5 minutes.

  2. 2

    Drain noodles and rinse under cold running water until chilled, tossing gently to cool evenly.

  3. 3

    In a small bowl, whisk soy sauce, rice vinegar, gochujang, and 2 tbsp cold water until smooth. Set aside.

  4. 4

    Bring water back to a gentle boil, add eggs, and cook until soft-boiled with jammy yolks, about 6 minutes. Transfer to ice water.

  5. 5

    Julienne the cucumber into thin matchsticks using a knife or mandoline.

  6. 6

    Divide noodles between two bowls, top with cucumber, peel and halve a soft-boiled egg over each, then pour sauce over and serve immediately.

Tools you’ll need

  • large pot
  • colander
  • small mixing bowl
  • whisk
  • slotted spoon
  • knife or mandoline

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.