Coconut Macaroon Bites
No-bake coconut bites with just four ingredients and zero oven time. Chewy, lightly sweet, ready to eat in under 10 minutes.
- Total time
- 10 min
- Servings
- 12
- Calories
- 156
- Protein
- 1g
simpleindulgentvegetarianchewycrispysnackcookiesnack
Ingredients
- 2 cups sweetened shredded coconut
- ½ cup sweetened condensed milk
- ½ tsp vanilla extract
- ½ cup dark chocolate chips
Instructions
- 1
Stir together coconut, condensed milk, and vanilla until fully combined.
- 2
Scoop mixture into 1-inch balls using a cookie scoop or spoon.
- 3
Microwave chocolate chips in 30-second bursts, stirring between, until melted.
- 4
Dip each bite halfway into melted chocolate; place on parchment to set.
- 5
Refrigerate 5 minutes until chocolate hardens. Serve cold.
Tools you’ll need
- mixing bowl
- spoon or cookie scoop
- microwave-safe bowl
- microwave
- parchment paper
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
