CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Coconut Laksa with Shrimp

Creamy, spicy coconut broth loaded with tender shrimp and noodles. Laksa paste does the heavy lifting—just add coconut milk, broth, and seafood.

Total time
20 min
Servings
2
Calories
420
Protein
28g
Coconut Laksa with Shrimp
comfortboldthaishrimpcreamytenderweeknightsoup

Ingredients

  • 3 tbsp laksa paste (red or Penang style)
  • 1 can (13.5 oz) coconut milk (full-fat)
  • 2 cups seafood or vegetable broth
  • ½ lb shrimp, peeled and deveined
  • 4 oz rice noodles or egg noodles
  • ½ whole lime (juiced)
  • ¼ cup green onions or fresh cilantro, chopped

Instructions

  1. 1

    Bring a large pot of salted water to boil. Add noodles and cook until just tender, ~4 minutes. Drain and set aside.

  2. 2

    In the same pot, heat 1 tbsp oil over medium-high. Add laksa paste and cook, stirring, until fragrant, ~1 minute.

  3. 3

    Pour in coconut milk and broth, stirring to break up the paste. Bring to a gentle simmer.

  4. 4

    Add shrimp and cook until pink and cooked through, 3–4 minutes. Do not stir constantly; let them sear lightly.

  5. 5

    Squeeze lime juice into the broth. Taste and adjust with salt and more lime as needed.

  6. 6

    Divide noodles between bowls, ladle broth and shrimp over top, and scatter green onions on the surface.

Tools you’ll need

  • large pot
  • wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.