CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Quick Seafood Laksa

A vibrant, aromatic coconut seafood soup built in one pot using laksa paste and fresh shrimp. Ready in 20 minutes with bold spice and tender seafood.

Total time
20 min
Servings
2
Calories
320
Protein
28g
Quick Seafood Laksa
comfortboldthaishrimpsilkytenderweeknightsoup

Ingredients

  • 1 can (13.5 oz) coconut milk
  • 1 cup seafood or chicken broth
  • 2 tablespoons laksa paste (red curry paste or laksa spice blend)
  • ½ pound large shrimp, peeled and deveined
  • 1 whole lime, halved
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Pour the coconut milk and broth into a large pot and place it on the stovetop over medium-high heat.

  2. 2

    Add the laksa paste to the pot and whisk it into the liquid until completely smooth with no lumps, about 1 minute.

  3. 3

    Bring the mixture to a gentle simmer — you should see small bubbles breaking the surface regularly — then reduce heat to medium.

  4. 4

    Add the shrimp to the simmering broth, stirring gently once or twice so they cook evenly.

  5. 5

    Let the shrimp cook in the simmering broth until they turn pink and opaque throughout, about 4–5 minutes.

  6. 6

    Squeeze the juice from both lime halves into the pot and stir to distribute the juice evenly.

  7. 7

    Taste the broth and add a pinch of salt and pepper if needed, then pour the laksa into serving bowls.

Tools you’ll need

  • large pot (4-quart minimum)
  • wooden spoon or silicone spatula
  • whisk
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.