CookSnap is coming soon — Join the waitlist →
Back to recipes

Kuay Teow Tom Yum

Silky rice noodles in a fragrant, spicy tom yum broth with shrimp, chicken, and fresh herbs. Ready in 30 minutes with bold, authentic Thai flavors.

Total time
30 min
Servings
2
Calories
420
Protein
38g
Kuay Teow Tom Yum
comfortboldthaishrimpchickensilkytenderweeknight

Ingredients

  • ½ lb chicken breast
  • ½ lb medium shrimp, peeled and deveined
  • 8 oz dried rice noodles (4-5 mm wide)
  • 4 cups chicken broth
  • 3 tbsp tom yum paste
  • 1 whole lime
  • 1 tbsp fish sauce
  • ½ cup fresh cilantro and Thai basil, chopped
  • 2 whole Thai chilies or jalapeños, sliced

Instructions

  1. 1

    Cut chicken breast into bite-sized pieces, roughly 1 inch.

  2. 2

    Soak rice noodles in room-temperature water for 15 minutes until pliable.

  3. 3

    Bring chicken broth to a boil in a large pot over medium-high heat.

  4. 4

    Stir in tom yum paste until dissolved, about 1 minute.

  5. 5

    Add chicken pieces and simmer 5 minutes until cooked through.

  6. 6

    Add shrimp and drained noodles. Simmer 3 minutes until shrimp pink.

  7. 7

    Squeeze lime juice into the pot. Stir in fish sauce and taste.

  8. 8

    Divide noodles and broth between two bowls.

  9. 9

    Top with cilantro, Thai basil, and sliced chilies. Serve immediately.

Tools you’ll need

  • large pot (6-8 quart capacity)
  • wooden spoon for stirring
  • colander for draining noodles
  • bowls for serving

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.