CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Coconut Laksa with Prawns

Silky coconut curry broth loaded with tender prawns, noodles, and fresh herbs — ready in under 20 minutes using a laksa paste shortcut. One pot, restaurant-level flavor.

Total time
20 min
Servings
4
Calories
420
Protein
28g
20-Min Coconut Laksa with Prawns
comfortboldmalaysianshrimpsilkytenderweeknightsoup

Ingredients

  • 3 tbsp laksa paste
  • 1 can (13.5 oz) coconut milk
  • 2 cups fish stock or water
  • 1 lb large prawns, peeled and deveined
  • 8 oz fresh ramen noodles or egg noodles
  • 4 heads bok choy, halved
  • 1 whole lime
  • ½ cup fresh cilantro and Thai basil, chopped

Instructions

  1. 1

    Heat oil in a large pot over medium-high. Stir in laksa paste until fragrant, about 1 minute.

  2. 2

    Pour in coconut milk and fish stock, stirring to combine. Bring to a simmer, then add prawns.

  3. 3

    Cook prawns until opaque and firm, 3–4 minutes. Do not overcook or they'll turn rubbery.

  4. 4

    Add noodles and bok choy. Simmer until noodles are tender and greens are wilted, about 3 minutes.

  5. 5

    Squeeze lime juice into the pot. Taste and adjust salt or heat with extra laksa paste if needed.

  6. 6

    Ladle into bowls and top generously with fresh cilantro and Thai basil.

Tools you’ll need

  • large pot (3-quart or larger)
  • wooden spoon
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Malaysian recipes →