Custrd is out on the App Store — Download it free →
Back to recipes

Coconut Crusted French Toast

Crispy coconut-coated French toast with custardy centers and a hint of vanilla. Ready in under 20 minutes for a showstopping breakfast that tastes indulgent but requires just one pan.

Total time
20 min
Servings
2
Calories
425
Protein
11g
Coconut Crusted French Toast
indulgentcozyamericanvegetarianeggscrispyfluffycreamy

Ingredients

  • 2 large eggs
  • ⅓ cup whole milk
  • ¾ cup unsweetened shredded coconut
  • 4 slices (1-inch thick) bread (brioche or challah), sliced
  • ½ teaspoon vanilla extract
  • 2 tablespoons butter
  • 2 tablespoons maple syrup or honey

Instructions

  1. 1

    Whisk eggs, milk, and vanilla together in a shallow bowl until combined and frothy.

  2. 2

    Spread shredded coconut on a plate in an even layer.

  3. 3

    Dip each bread slice into egg mixture, coating both sides — 2 seconds per side.

  4. 4

    Coat both sides of each dipped slice generously with coconut, pressing gently.

  5. 5

    Heat butter in a 12-inch nonstick skillet over medium-high until foaming.

  6. 6

    Pan-fry French toast 3 minutes per side until coconut is golden and edges firm.

  7. 7

    Transfer to plates and drizzle with maple syrup or honey. Serve immediately.

Tools you’ll need

  • shallow bowl
  • whisk
  • plate
  • 12-inch nonstick skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.