CookSnap is coming soon — Join the waitlist →
Back to recipes

Classic Brioche French Toast

Golden, custard-soaked brioche slices cooked until crispy outside and creamy inside. Ready in 15 minutes and perfect for a simple breakfast or brunch.

Total time
15 min
Servings
2
Calories
298
Protein
9g
Classic Brioche French Toast
comfortindulgentfrenchvegetarianeggscrispycreamyfluffy

Ingredients

  • 2 large eggs
  • ⅓ cup whole milk
  • 1 tablespoon granulated sugar
  • ½ teaspoon vanilla extract
  • 4 slices brioche, sliced
  • 1.5 tablespoon butter

Instructions

  1. 1

    Crack the 2 eggs into a shallow bowl (like a cereal bowl). Pour in 0.33 cup milk, 1 tablespoon sugar, and 0.5 teaspoon vanilla extract.

  2. 2

    Whisk the egg mixture with a fork for about 20 seconds until the color is uniform and no streaks of white remain.

  3. 3

    Place a 10-inch skillet over medium heat and add 1.5 tablespoons butter. Wait about 60 seconds until the butter melts completely and smells nutty.

  4. 4

    Pick up one brioche slice with your fingers, dip it into the egg mixture for 1 full second on each side (do not soak), and place it in the hot skillet.

  5. 5

    Repeat with the remaining 3 brioche slices, placing them in the skillet so they do not touch each other.

  6. 6

    Cook for 2 to 3 minutes until the bottom of each slice turns golden brown (the color of caramel candy) and the edges look darker and crispy.

  7. 7

    Using a thin metal spatula, slide it under each slice and flip it over in one quick motion.

  8. 8

    Cook the second side for 1 to 2 minutes until it also turns golden brown and feels slightly firm when you press the center with your finger.

  9. 9

    Transfer the 4 slices to a serving plate. Top with fresh berries, maple syrup, powdered sugar, or whipped cream as desired.

Tools you’ll need

  • shallow bowl (cereal bowl size)
  • fork
  • 10-inch skillet
  • thin metal spatula
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.