5-Minute Chocolate Banana Bread Bites
No-bake chocolate banana bites that taste like banana bread in snack form. Ready in minutes with just bananas, chocolate, and pantry staples.
- Total time
- 10 min
- Servings
- 4
- Calories
- 210
- Protein
- 5g
quicksatisfyingvegetarianchewycrispysnackappetizersnack
Ingredients
- 2 ripe bananas
- ½ cup chocolate chips (dark or milk)
- 3 tbsp creamy peanut butter
- ¼ cup graham cracker crumbs
- 1 pinch salt
Instructions
- 1
Slice bananas into 1/4-inch-thick rounds.
- 2
Combine chocolate chips, peanut butter, and salt in a microwave-safe bowl.
- 3
Microwave in 30-second bursts, stirring between, until melted and smooth.
- 4
Dip banana rounds halfway into chocolate, then roll the chocolate side in graham cracker crumbs.
- 5
Place on parchment paper and refrigerate 5 minutes until chocolate sets.
- 6
Serve cold or at room temperature.
Tools you’ll need
- microwave-safe bowl
- microwave
- spoon
- parchment paper
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
