CookSnap is coming soon — Join the waitlist →
Back to recipes

Chipotle-Honey Salmon with Roasted Veg

Salmon glazed with spicy-sweet chipotle and honey, seared and finished in the oven alongside roasted beets, asparagus, and parsnips. Creamed spinach and red pepper purée serve as silky sides.

Total time
25 min
Servings
2
Calories
380
Protein
40g
Chipotle-Honey Salmon with Roasted Veg
satisfyingboldamericanfishcrispytenderflakyweeknight

Ingredients

  • 2 fillets (6 oz each) salmon fillets
  • 2 peppers, finely chopped chipotle peppers in adobo
  • 2 tbsp honey
  • 1 whole (juiced) lime

Instructions

  1. 1

    Mix chipotle, honey, and lime juice in a small bowl until smooth.

  2. 2

    Pat salmon dry and season with salt and pepper on both sides.

  3. 3

    Sear salmon skin-side up in a hot oiled skillet 2 minutes until edges brown.

  4. 4

    Flip salmon, brush with chipotle glaze, then transfer skillet to a 400°F oven.

  5. 5

    Bake 8–10 minutes until the center flakes with gentle pressure.

  6. 6

    Serve salmon hot with roasted beets, asparagus, parsnips, creamed spinach, and red pepper purée.

Tools you’ll need

  • 12-inch cast-iron or heavy stainless-steel skillet
  • small mixing bowl
  • oven
  • instant-read thermometer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.