Chipotle-Honey Salmon with Pesto Pasta
Salmon fillets glazed with smoky chipotle and honey, baked until flaky, served alongside quick pesto pasta and roasted potatoes. Ready in under 20 minutes.
- Total time
- 20 min
- Servings
- 2
- Calories
- 340
- Protein
- 38g
quicksatisfyingamericansalmonflakytenderweeknightmain-dish
Ingredients
- 2 pieces (6 oz each) salmon fillets
- 2 tbsp, finely chopped chipotle peppers in adobo
- 2 tbsp honey
- ½ whole (juiced) lime
Instructions
- 1
Preheat oven to 400°F and line a sheet pan with parchment paper.
- 2
Pat salmon fillets dry and arrange skin-side down on the sheet pan.
- 3
Stir chipotle peppers, honey, and lime juice in a small bowl until combined.
- 4
Spread the chipotle glaze evenly over the salmon fillets.
- 5
Bake for 12–14 minutes until the flesh flakes easily with a fork.
- 6
Serve hot with pesto pasta, roasted potatoes, and lime wedges.
Tools you’ll need
- sheet pan
- parchment paper
- small bowl
- oven
- fork
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
