CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Chipotle Beef Sopes — Crispy & Tangy

Crispy fried masa cups loaded with shredded chipotle beef, topped with crema and pickled onions. Ready in 25 minutes — weeknight dinner that feels like a taquería.

Total time
25 min
Servings
2
Calories
520
Protein
38g
Chipotle Beef Sopes — Crispy & Tangy
casualsatisfyingmexicanbeefcrispytenderweeknightdinner

Ingredients

  • 1 lb beef sirloin or chuck, sliced thin
  • 2 peppers canned chipotle peppers in adobo sauce
  • 1.5 cups masa harina (corn flour for tortillas)
  • ½ medium red onion, thinly sliced
  • 1 whole lime (juiced)
  • ¼ cup crema or sour cream

Instructions

  1. 1

    Mix masa harina with 1 cup warm water and a pinch of salt until it forms a soft, Play-Doh-like dough.

  2. 2

    Divide dough into 6 portions. Press each between plastic wrap into a thin disc, then pinch edges up to form a shallow cup.

  3. 3

    Heat oil in a skillet over medium-high. Fry each masa cup until golden and crispy, 2–3 minutes per side. Drain on paper towels.

  4. 4

    In the same skillet, brown beef over high heat, breaking it apart with a spoon, 4–5 minutes. Chop chipotles, add to beef with 2 tbsp adobo sauce, and stir 30 seconds.

  5. 5

    Toss red onion with lime juice and a pinch of salt. Let sit while beef finishes.

  6. 6

    Fill each masa cup with chipotle beef, top with crema and pickled onions. Serve hot.

Tools you’ll need

  • medium bowl
  • plastic wrap
  • 12-inch skillet
  • wooden spoon
  • paper towels
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.