CookSnap is coming soon — Join the waitlist →
Back to recipes

Chimney Cake with Cinnamon Sugar

Crispy, airy Hungarian street pastry wrapped around a wooden mold, brushed with butter, and rolled in cinnamon sugar. Golden and warm in under 25 minutes.

Total time
25 min
Servings
4
Calories
380
Protein
6g
Chimney Cake with Cinnamon Sugar
indulgentcasualhungarianvegetariancrispyairyflakyweekend

Ingredients

  • 2 cups all-purpose flour
  • ¾ cup warm milk
  • 4 tbsp butter, melted
  • ¼ cup granulated sugar
  • 2 tsp ground cinnamon
  • 1 whole egg
  • ½ cup chopped walnuts or hazelnuts (optional)

Instructions

  1. 1

    Mix flour, milk, egg, and a pinch of salt until you have a thick, smooth batter. Let it rest 5 minutes.

  2. 2

    In a shallow bowl, combine cinnamon and sugar. Set aside. Heat oil in a deep skillet over medium-high heat.

  3. 3

    Dip a cone or cylindrical wooden mold into the batter to coat evenly on all sides, leaving the tip exposed.

  4. 4

    Slide the mold into hot oil and fry 2–3 minutes, rotating gently, until golden and crispy all over.

  5. 5

    Remove from oil and slide the pastry off the mold onto a plate. Brush generously with melted butter.

  6. 6

    Roll the warm pastry in the cinnamon-sugar mix, coating all sides. Sprinkle chopped nuts if using. Serve warm.

Tools you’ll need

  • medium mixing bowl
  • shallow bowl
  • deep skillet or heavy frying pan
  • wooden cone or cylindrical mold (or DIY aluminum foil cone)
  • tongs or spider strainer
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.