Chili Lime Popcorn
Crispy popcorn coated in a tangy-spicy chili-lime seasoning. Ready in minutes with just five pantry staples—the perfect snack for movie night or quick cravings.
- Total time
- 10 min
- Servings
- 4
- Calories
- 85
- Protein
- 2g
casualquickveganvegetariandairy-freecrispycrunchyweeknight
Ingredients
- ⅓ cup popcorn kernels
- 1 tbsp olive oil
- 1 tsp chili powder
- 1 whole lime (zested + juiced)
- ½ tsp salt
Instructions
- 1
Pop popcorn in oil using stovetop method, covered pot, or air popper until kernels slow to 2–3 seconds apart.
- 2
Transfer popped corn to a large bowl. Drizzle with lime juice while still warm.
- 3
Sprinkle chili powder, lime zest, and salt evenly over popcorn.
- 4
Toss vigorously until every piece is coated. Serve immediately.
Tools you’ll need
- large heavy-bottomed pot with lid (stovetop method) or air popper
- large mixing bowl
- microplane or fine grater (for lime zest)
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
