CookSnap is coming soon — Join the waitlist →
Back to recipes

Chili Lime Popcorn

Crispy popcorn coated in a tangy-spicy chili-lime seasoning. Ready in minutes with just five pantry staples—the perfect snack for movie night or quick cravings.

Total time
10 min
Servings
4
Calories
85
Protein
2g
Chili Lime Popcorn
casualquickveganvegetariandairy-freecrispycrunchyweeknight

Ingredients

  • ⅓ cup popcorn kernels
  • 1 tbsp olive oil
  • 1 tsp chili powder
  • 1 whole lime (zested + juiced)
  • ½ tsp salt

Instructions

  1. 1

    Pop popcorn in oil using stovetop method, covered pot, or air popper until kernels slow to 2–3 seconds apart.

  2. 2

    Transfer popped corn to a large bowl. Drizzle with lime juice while still warm.

  3. 3

    Sprinkle chili powder, lime zest, and salt evenly over popcorn.

  4. 4

    Toss vigorously until every piece is coated. Serve immediately.

Tools you’ll need

  • large heavy-bottomed pot with lid (stovetop method) or air popper
  • large mixing bowl
  • microplane or fine grater (for lime zest)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.