CookSnap is coming soon — Join the waitlist →

Chili Crisp Pork with Green Beans

Pad Prik King stripped down to its essence: pork belly stir-fried with green beans, garlic, and a punchy chili-oil sauce that tastes like a restaurant version. Ready in 18 minutes flat.

Total time
18 min
Servings
2
Calories
385
Protein
28g
Chili Crisp Pork with Green Beans
quicksatisfyingthaiporkcrispytenderweeknightstir-fry

Ingredients

  • ¾ lb pork belly or pork shoulder, cut into thin bite-sized pieces
  • 8 oz green beans, trimmed and cut into 2-inch pieces
  • 3 tbsp chili crisp (Lao Gan Ma or similar)
  • 1.5 tbsp fish sauce
  • 4 cloves garlic, minced
  • 1 tbsp red curry paste

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  2. 2

    Add pork pieces and cook without stirring until edges brown, 3–4 minutes; stir and cook 2 more minutes until no pink remains.

  3. 3

    Add minced garlic and curry paste, stir constantly until fragrant, about 30 seconds.

  4. 4

    Add green beans, chili crisp, and fish sauce; toss to coat and cook until beans are just tender-crisp, 4–5 minutes.

  5. 5

    Taste and adjust seasoning with more fish sauce or chili crisp if needed.

  6. 6

    Serve hot over jasmine rice or with sticky rice on the side.

Tools you’ll need

  • 12-inch skillet with a lid
  • cutting board and knife
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.