CookSnap is coming soon — Join the waitlist →

20-Min Chili-Crisp Beef Mole

Skip the 2-hour simmer: this quick mole uses jarred mole paste as the anchor, beefed up with chili crisp for heat and depth. Ground beef cooks fast, pooled into silky sauce.

Total time
20 min
Servings
4
Calories
380
Protein
28g
20-Min Chili-Crisp Beef Mole
comfortquickmexicanbeeftendercreamyweeknightmain-dish

Ingredients

  • 1 lb ground beef
  • ¾ cup jarred mole paste
  • 1 cup beef broth
  • 2 tbsp chili crisp (like Lao Gan Ma)
  • ½ medium yellow onion, diced
  • ¼ cup cilantro (fresh, chopped)
  • 1 whole lime

Instructions

  1. 1

    Heat oil in a large skillet over medium-high. Brown ground beef, breaking up with a spoon, until no pink remains, about 5 minutes.

  2. 2

    Add diced onion to the beef. Stir and cook until onion softens, about 2 minutes.

  3. 3

    Stir in mole paste and beef broth until smooth. Bring to a gentle simmer.

  4. 4

    Simmer for 8 minutes, stirring occasionally, until sauce darkens and thickens slightly.

  5. 5

    Stir in chili crisp. Squeeze lime juice over the pot and taste for salt.

  6. 6

    Serve over rice or with warm tortillas. Garnish with cilantro.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • measuring spoons
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.