Custrd is out on the App Store — Download it free →
Back to recipes

Chili Crisp Avocado Toast

Creamy smashed avocado on crispy toast, topped with everything bagel seasoning and a drizzle of chili crisp. Ready in 5 minutes, zero cooking required beyond toasting bread.

Total time
5 min
Servings
2
Calories
248
Protein
6g
Chili Crisp Avocado Toast
casualquickcalifornianvegetarianvegancrispycreamyweeknight

Ingredients

  • 2 slices bread (sourdough or whole grain)
  • 1 whole ripe avocado
  • ½ tsp everything bagel seasoning
  • 1 tbsp chili crisp oil
  • ½ whole lemon

Instructions

  1. 1

    Toast bread until golden and crispy, about 2 minutes.

  2. 2

    Halve the avocado, scoop flesh into a bowl, and mash with a fork until chunky-creamy.

  3. 3

    Squeeze lemon juice over the mashed avocado and pinch of salt; stir gently.

  4. 4

    Divide mashed avocado between the two toasts and spread to the edges.

  5. 5

    Sprinkle everything seasoning evenly over both toasts.

  6. 6

    Drizzle chili crisp oil over the top and serve immediately.

Tools you’ll need

  • toaster
  • small bowl
  • fork

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.