Chili Crisp Avocado Toast
Creamy smashed avocado on crispy toast, topped with everything bagel seasoning and a drizzle of chili crisp. Ready in 5 minutes, zero cooking required beyond toasting bread.
- Total time
- 5 min
- Servings
- 2
- Calories
- 248
- Protein
- 6g

casualquickcalifornianvegetarianvegancrispycreamyweeknight
Ingredients
- 2 slices bread (sourdough or whole grain)
- 1 whole ripe avocado
- ½ tsp everything bagel seasoning
- 1 tbsp chili crisp oil
- ½ whole lemon
Instructions
- 1
Toast bread until golden and crispy, about 2 minutes.
- 2
Halve the avocado, scoop flesh into a bowl, and mash with a fork until chunky-creamy.
- 3
Squeeze lemon juice over the mashed avocado and pinch of salt; stir gently.
- 4
Divide mashed avocado between the two toasts and spread to the edges.
- 5
Sprinkle everything seasoning evenly over both toasts.
- 6
Drizzle chili crisp oil over the top and serve immediately.
Tools you’ll need
- toaster
- small bowl
- fork
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

