CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Chickpea Buddha Bowl with Tahini Drizzle

Warm grains, roasted chickpeas, and fresh vegetables topped with a creamy tahini sauce. Ready in 25 minutes with zero chopping fuss.

Total time
25 min
Servings
2
Calories
385
Protein
12g
Chickpea Buddha Bowl with Tahini Drizzle
wholesomequickmediterraneanvegetarianveganchickpeascrispycreamy

Ingredients

  • 1 can (15 oz) canned chickpeas (drained and patted dry)
  • 1.5 cups cooked rice or quinoa (warm)
  • 1 cup cherry tomatoes (halved)
  • ½ medium cucumber (sliced)
  • 3 tbsp tahini
  • 2 tbsp lemon juice

Instructions

  1. 1

    Preheat oven to 425°F. Pat chickpeas very dry with paper towels.

  2. 2

    Toss chickpeas with 1 tbsp olive oil, salt, and pepper. Spread on a baking sheet.

  3. 3

    Roast chickpeas 12–15 minutes, shaking halfway through, until edges are crispy.

  4. 4

    Whisk tahini, lemon juice, 2 tbsp water, salt, and pepper until pourable.

  5. 5

    Divide warm rice between two bowls. Arrange tomatoes and cucumber alongside.

  6. 6

    Top with roasted chickpeas. Drizzle tahini sauce over the entire bowl.

Tools you’ll need

  • baking sheet
  • paper towels
  • small bowl
  • whisk
  • serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.