Custrd is out on the App Store — Download it free →
Back to recipes

Chicken with Cream and Mushrooms

A quick and creamy skillet chicken dish with mushrooms, served with crispy fries. Perfect for a busy weeknight.

Total time
25 min
Servings
4
Calories
650
Protein
35g
Chicken with Cream and Mushrooms
comfortingAmericangluten-freechickencreamycrispyweeknightmain course

Ingredients

  • 2 large chicken breast
  • 8 oz mushrooms
  • 1 cup heavy cream
  • 1 lb frozen french fries
  • 2 tbsp butter
  • 1 tsp salt

Instructions

  1. 1

    Preheat oven to 425°F. Spread the 1 lb frozen fries on a baking sheet and bake until golden and crispy, about 20 minutes, shaking halfway.

  2. 2

    While fries bake, season the 2 chicken breasts with 1/2 tsp salt. Melt 1 tbsp butter in a large skillet over medium-high heat.

  3. 3

    Add chicken and cook until golden brown and cooked through, about 6 minutes per side. Transfer to a plate.

  4. 4

    Add remaining 1 tbsp butter and 8 oz sliced mushrooms to the skillet. Cook until mushrooms are browned and tender, about 5 minutes.

  5. 5

    Pour in 1 cup heavy cream and remaining 1/2 tsp salt. Simmer until slightly thickened, about 3 minutes. Return chicken to pan, coat with sauce, and serve with fries.

Tools you’ll need

  • baking sheet
  • large skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.