Custrd is out on the App Store — Download it free →
Back to recipes

Chicken Sope

A crispy corn base topped with shredded chicken, fresh tomato salsa, crumbled cheese, and a drizzle of crema. A satisfying Mexican-inspired weeknight dinner.

Total time
35 min
Servings
4
Calories
380
Protein
28g
Chicken Sope
comfortingMexicangluten-freechickencrispycreamyweeknightmain

Ingredients

  • 1 cup masa harina
  • ¾ cup water
  • 2 cups shredded cooked chicken
  • 2 medium tomatoes
  • ½ small onion
  • ½ cup cotija cheese
  • ¼ cup crema
  • 2 tbsp vegetable oil

Instructions

  1. 1

    In a bowl, mix 1 cup masa harina with 0.75 cup water and a pinch of salt until a soft dough forms. If too dry, add water 1 tbsp at a time.

  2. 2

    Divide dough into 4 balls. Press each into a 4-inch round, about 1/4-inch thick, using a tortilla press or your hands.

  3. 3

    Heat 2 tbsp vegetable oil in a skillet over medium. Cook the sopes until golden and crisp, about 3 minutes per side. Remove and set aside.

  4. 4

    While sopes cook, dice 2 tomatoes and 0.5 small onion. Mix with a pinch of salt to make a fresh salsa.

  5. 5

    Top each sope with 0.5 cup shredded chicken, then spoon the tomato salsa over.

  6. 6

    Crumble 0.5 cup cotija cheese over the top and drizzle with 0.25 cup crema. Serve warm.

  7. 7

    Optional: add chopped cilantro or a squeeze of lime for extra freshness.

Tools you’ll need

  • skillet
  • mixing bowl
  • tortilla press (optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.