CookSnap is coming soon — Join the waitlist →

Chicken Liver Crostini with Sweet Chili

Crispy toasted bread topped with a quick pan-seared chicken liver spread and a drizzle of sweet chili sauce. Restaurant-quality Italian appetizer that tastes like you spent hours but takes 20 minutes.

Total time
20 min
Servings
4
Calories
285
Protein
14g
Chicken Liver Crostini with Sweet Chili
elegantquickitalianchickencrispycreamyweeknightappetizer

Ingredients

  • 6 oz chicken livers
  • 1 loaf baguette or ciabatta
  • 1 medium shallot, minced
  • 3 tbsp white wine or dry vermouth
  • 2 tbsp butter
  • 3 tbsp sweet chili sauce
  • 1 tsp fresh thyme or sage, chopped

Instructions

  1. 1

    Slice baguette on a sharp diagonal into 1/4-inch-thick pieces. Lay them flat on a sheet pan and toast under the broiler until golden, 2–3 minutes per side.

  2. 2

    Pat chicken livers dry with paper towels. Season generously with salt and black pepper.

  3. 3

    Heat butter in a large skillet over medium-high until it foams. Add shallot and cook until fragrant, 60 seconds.

  4. 4

    Add chicken livers and sear without stirring for 2 minutes. Flip and cook 90 seconds more — center should be barely pink.

  5. 5

    Pour white wine into the skillet and scrape up browned bits. Simmer 30 seconds, then remove from heat and stir in thyme.

  6. 6

    Mash livers and pan juices with a fork until spreadable but still chunky. Spoon onto toasted bread and drizzle with sweet chili sauce.

Tools you’ll need

  • sheet pan
  • broiler or oven
  • paper towels
  • large skillet (12-inch)
  • fork or small wooden spoon
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.